settings Currency keyboard_arrow_down
EURAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
language Lingua keyboard_arrow_down
ItalyEnglish
menu
phoneemail
shopping_cart carrello (0)
Special Offers
location_on
Bape City Glow In The Dark camo shark hoodie black
Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black Bape City Glow In The Dark camo shark hoodie black

Bape City Glow In The Dark camo shark hoodie black

Product Code:  8pSUtie
Product Description
250,00 € inc. imposta
Add to Cart Quantity
Product Details
Product Condition: Nuovo
Updating Order Details
Please do not refresh or navigate away from the page!
Descrizione del prodotto
No Reviews Posted Yet - be the first! write review
Featured Products
Prodotto aggiunto al carrello
x

-------- o --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i