settings Currency keyboard_arrow_down
EURAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
language Lingua keyboard_arrow_down
ItalyEnglish
menu
phoneemail
shopping_cart carrello (0)
Special Offers
location_on
Nike Dunk Low Off-White Pine Green
Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green Nike Dunk Low Off-White Pine Green

Nike Dunk Low Off-White Pine Green

Product Code:  wBM9bm0
Product Description
220,00 € inc. imposta
Add to Cart Quantity
Product Details
Product Condition: Nuovo
Updating Order Details
Please do not refresh or navigate away from the page!
Descrizione del prodotto
No Reviews Posted Yet - be the first! write review
Featured Products
Prodotto aggiunto al carrello
x

-------- o --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i